SCOP 1.59: Domain d1dmpa_: 1dmp A:

Lineage for d1dmpa_ (1dmp A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)

8. Domain d1dmpa_: 1dmp A: [26638]

Details for d1dmpa_

PDB Entry: 1dmp, 2 Å

PDB Description: structure of hiv-1 protease complex

SCOP Domain Sequences for d1dmpa_:

Sequence; same for both SEQRES and ATOM records:

>d1dmpa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d1dmpa_:

• d1dmpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dmpa_ appears in SCOP 1.57
  
• d1dmpa_ appears in SCOP 1.61
  
• d1dmpa_ appears in the current release, SCOPe 2.08