Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Enterococcus gallinarum [TaxId:565653] [267945] (1 PDB entry) |
Domain d4hnla1: 4hnl A:1-115 [266359] Other proteins in same PDB: d4hnla2, d4hnla3 automated match to d3gy1a1 complexed with cl, gol, mg |
PDB Entry: 4hnl (more details), 1.48 Å
SCOPe Domain Sequences for d4hnla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnla1 d.54.1.0 (A:1-115) automated matches {Enterococcus gallinarum [TaxId: 565653]} mtptiitdvksfaikpdrhnlvvvkvetnkgisglgcstfqfrplavktvvdeylrpllm grdaneiediwqvmnvnsywrngpitnnaisgidmalwdikgqladmplyqllgg
Timeline for d4hnla1: