Lineage for d4hnla1 (4hnl A:1-115)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555084Species Enterococcus gallinarum [TaxId:565653] [267945] (1 PDB entry)
  8. 2555085Domain d4hnla1: 4hnl A:1-115 [266359]
    Other proteins in same PDB: d4hnla2, d4hnla3
    automated match to d3gy1a1
    complexed with cl, gol, mg

Details for d4hnla1

PDB Entry: 4hnl (more details), 1.48 Å

PDB Description: crystal structure of enolase egbg_01401 (target efi-502226) from enterococcus gallinarum eg2
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4hnla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnla1 d.54.1.0 (A:1-115) automated matches {Enterococcus gallinarum [TaxId: 565653]}
mtptiitdvksfaikpdrhnlvvvkvetnkgisglgcstfqfrplavktvvdeylrpllm
grdaneiediwqvmnvnsywrngpitnnaisgidmalwdikgqladmplyqllgg

SCOPe Domain Coordinates for d4hnla1:

Click to download the PDB-style file with coordinates for d4hnla1.
(The format of our PDB-style files is described here.)

Timeline for d4hnla1: