Class b: All beta proteins [48724] (144 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (166 PDB entries) |
Domain d1b6pa_: 1b6p A: [26635] |
PDB Entry: 1b6p (more details), 2 Å
SCOP Domain Sequences for d1b6pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6pa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1} pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
Timeline for d1b6pa_: