SCOPe 2.07: Domain d4gisb2: 4gis B:116-399

Lineage for d4gisb2 (4gis B:116-399)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Vibrio harveyi [TaxId:673519] [267937] (3 PDB entries)

8. Domain d4gisb2: 4gis B:116-399 [266321]
   Other proteins in same PDB: d4gisa1, d4gisa3, d4gisb1, d4gisb3
   automated match to d4ihca2
   complexed with cl, gol, mae, mg, mla

Details for d4gisb2

PDB Entry: 4gis, 1.8 Å

PDB Description: crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, glycerol and dicarboxylates bound (mixed loops, space group i4122)

PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d4gisb2:

Sequence, based on SEQRES records:

>d4gisb2 c.1.11.0 (B:116-399) automated matches {Vibrio harveyi [TaxId: 673519]}
ksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsy
ydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilp
psqtewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklgh
fcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaeping
ylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp

Sequence, based on observed residues (ATOM records):

>d4gisb2 c.1.11.0 (B:116-399) automated matches {Vibrio harveyi [TaxId: 673519]}
ksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyniqtaqnptqgsyydqdq
yientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilppsqte
wldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklghfcesf
gvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepingylyas
eiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp

Timeline for d4gisb2:

• d4gisb2 first appeared in SCOPe 2.05
  
• d4gisb2 appears in SCOPe 2.06
  
• d4gisb2 appears in the current release, SCOPe 2.08