![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
![]() | Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
![]() | Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
![]() | Protein automated matches [259190] (2 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries) |
![]() | Domain d4d1mg_: 4d1m G: [266148] automated match to d4d1lb_ complexed with zn |
PDB Entry: 4d1m (more details), 2.2 Å
SCOPe Domain Sequences for d4d1mg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d1mg_ a.53.1.0 (G:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} eeiftlqvrgreryeilkklndslelsdvvpasdaekyrq
Timeline for d4d1mg_: