Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
Protein automated matches [190229] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries) |
Domain d4cwqa_: 4cwq A: [266098] automated match to d2xjxa_ complexed with w2d |
PDB Entry: 4cwq (more details), 2 Å
SCOPe Domain Sequences for d4cwqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cwqa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte yleerrikeivkkhsqfigypitlfve
Timeline for d4cwqa_: