Lineage for d4c5ka1 (4c5k A:2-276)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2512071Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2512072Protein automated matches [190117] (50 species)
    not a true protein
  7. 2512343Species Staphylococcus aureus [TaxId:158878] [237768] (4 PDB entries)
  8. 2512344Domain d4c5ka1: 4c5k A:2-276 [265979]
    Other proteins in same PDB: d4c5ka2, d4c5kb2, d4c5kc2, d4c5kd2
    automated match to d4c5na_
    complexed with adp, so4

Details for d4c5ka1

PDB Entry: 4c5k (more details), 1.4 Å

PDB Description: Structure of the pyridoxal kinase from Staphylococcus aureus in complex with ADP
PDB Compounds: (A:) phosphomethylpyrimidine kinase

SCOPe Domain Sequences for d4c5ka1:

Sequence, based on SEQRES records: (download)

>d4c5ka1 c.72.1.0 (A:2-276) automated matches {Staphylococcus aureus [TaxId: 158878]}
alkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdvf
ekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpgn
teamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkal
dqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafv
asaikngwkmndfvgpvdhgaynriehidvevtev

Sequence, based on observed residues (ATOM records): (download)

>d4c5ka1 c.72.1.0 (A:2-276) automated matches {Staphylococcus aureus [TaxId: 158878]}
alkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdvf
ekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckdevlnpgnte
amikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkaldq
dksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafvas
aikngwkmndfvgpvdhgaynriehidvevtev

SCOPe Domain Coordinates for d4c5ka1:

Click to download the PDB-style file with coordinates for d4c5ka1.
(The format of our PDB-style files is described here.)

Timeline for d4c5ka1: