Lineage for d4a17u_ (4a17 U:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648152Protein Eukaryotic, cytoplasmic (60S subunit) [267687] (1 species)
  7. 2648153Species Tetrahymena thermophila [TaxId:5911] [268006] (2 PDB entries)
  8. 2648174Domain d4a17u_: 4a17 U: [265874]
    protein/RNA complex; complexed with mg, zn

Details for d4a17u_

PDB Entry: 4a17 (more details), 3.52 Å

PDB Description: T.thermophila 60S ribosomal subunit in complex with initiation factor 6. This file contains 5S rRNA, 5.8S rRNA and proteins of molecule 2.
PDB Compounds: (U:) rpl35

SCOPe Domain Sequences for d4a17u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a17u_ i.1.1.2 (U:) Eukaryotic, cytoplasmic (60S subunit) {Tetrahymena thermophila [TaxId: 5911]}
dksvrvfklrtqteeqlvgelgklqtelsqlriakiaggtanklgrigivrkaiakylti
inekrrqavkdqfkgkslkpldirvkktrairrkltkkqreavlvktqkklnnfglrkfa
lka

SCOPe Domain Coordinates for d4a17u_:

Click to download the PDB-style file with coordinates for d4a17u_.
(The format of our PDB-style files is described here.)

Timeline for d4a17u_: