Lineage for d3zixe1 (3zix E:38-199)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628346Fold f.8: Aerolisin/ETX pore-forming domain [56972] (1 superfamily)
    3 domains: (1) alpha+beta; (2&3) all-beta
  4. 2628347Superfamily f.8.1: Aerolisin/ETX pore-forming domain [56973] (3 families) (S)
  5. 2628379Family f.8.1.3: Clostridium perfringens enterotoxin (CPE), pore-forming domain [267612] (2 proteins)
    N-terminal part of Pfam PF03505, PubMed 21489981
  6. 2628383Protein automated matches [267674] (1 species)
    not a true protein
  7. 2628384Species Clostridium perfringens [TaxId:1502] [267811] (3 PDB entries)
  8. 2628395Domain d3zixe1: 3zix E:38-199 [265809]
    Other proteins in same PDB: d3zixa2, d3zixa3, d3zixb2, d3zixb3, d3zixc2, d3zixc3, d3zixd2, d3zixd3, d3zixe2, d3zixe3, d3zixf2, d3zixf3
    automated match to d3am2a2
    complexed with p6g

Details for d3zixe1

PDB Entry: 3zix (more details), 1.9 Å

PDB Description: Clostridium perfringens Enterotoxin with the N-terminal 37 residues deleted
PDB Compounds: (E:) heat-labile enterotoxin b chain

SCOPe Domain Sequences for d3zixe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zixe1 f.8.1.3 (E:38-199) automated matches {Clostridium perfringens [TaxId: 1502]}
sdglyvidkgdgwilgepsvvssqilnpnetgtfsqsltkskevsinvnfsvgftsefiq
asveygfgitigeqntiersvsttagpneyvyykvyatyrkyqairishgnisddgsiyk
ltgiwlsktsadslgnidqgslietgercvltvpstdiekei

SCOPe Domain Coordinates for d3zixe1:

Click to download the PDB-style file with coordinates for d3zixe1.
(The format of our PDB-style files is described here.)

Timeline for d3zixe1: