Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.37: Clostridium perfringens enterotoxin (CPE), C-terminal domain [267611] (2 proteins) C-terminal part of Pfam PF03505; PubMed 17977833 describes homology between (d2quoa_), (d1w99a3), and (d1nqdb_) |
Protein automated matches [267681] (1 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [267916] (2 PDB entries) |
Domain d3ziwd2: 3ziw D:200-319 [265796] Other proteins in same PDB: d3ziwa1, d3ziwa3, d3ziwb1, d3ziwb3, d3ziwc1, d3ziwc3, d3ziwd1, d3ziwd3, d3ziwe1, d3ziwe3, d3ziwf1, d3ziwf3 automated match to d3am2a1 complexed with p6g; mutant |
PDB Entry: 3ziw (more details), 1.9 Å
SCOPe Domain Sequences for d3ziwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ziwd2 b.18.1.37 (D:200-319) automated matches {Clostridium perfringens [TaxId: 1502]} ldlaaaterlnltdalnsnpagnlydwrssnsypwtqklnlhltitatgqkyrilaskiv dfniysnnfnnlvkleqslgdgvkdhyvdisldagqyvlvmkanssysgnypysilfqkf
Timeline for d3ziwd2: