SCOPe 2.07: Domain d3wglb1: 3wgl B:11-206

Lineage for d3wglb1 (3wgl B:11-206)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Staphylococcus aureus [TaxId:158878] [226455] (7 PDB entries)

8. Domain d3wglb1: 3wgl B:11-206 [265645]
   Other proteins in same PDB: d3wgla2, d3wglb2
   automated match to d4m8ia1
   complexed with gdp; mutant

Details for d3wglb1

PDB Entry: 3wgl, 3.07 Å

PDB Description: staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wglb1:

Sequence; same for both SEQRES and ATOM records:

>d3wglb1 c.32.1.1 (B:11-206) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
latlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglg
aganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvg
vvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvl
rqgvqgisdliavgan

Timeline for d3wglb1:

• d3wglb1 first appeared in SCOPe 2.05
  
• d3wglb1 appears in SCOPe 2.06
  
• d3wglb1 appears in the current release, SCOPe 2.08