Lineage for d3tw9c1 (3tw9 C:5-118)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555420Species Salmonella enterica [TaxId:550537] [267889] (3 PDB entries)
  8. 2555433Domain d3tw9c1: 3tw9 C:5-118 [265405]
    Other proteins in same PDB: d3tw9a2, d3tw9b2, d3tw9c2, d3tw9d2
    automated match to d4ihca1
    complexed with cl, gol

Details for d3tw9c1

PDB Entry: 3tw9 (more details), 1.7 Å

PDB Description: crystal structure of gluconate dehydratase (target efi-501679) from salmonella enterica subsp. enterica serovar enteritidis str. p125109
PDB Compounds: (C:) Putative dehydratase

SCOPe Domain Sequences for d3tw9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tw9c1 d.54.1.0 (C:5-118) automated matches {Salmonella enterica [TaxId: 550537]}
nlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapflvg
kdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllgg

SCOPe Domain Coordinates for d3tw9c1:

Click to download the PDB-style file with coordinates for d3tw9c1.
(The format of our PDB-style files is described here.)

Timeline for d3tw9c1: