Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Salmonella enterica [TaxId:550537] [267889] (3 PDB entries) |
Domain d3tw9c1: 3tw9 C:5-118 [265405] Other proteins in same PDB: d3tw9a2, d3tw9b2, d3tw9c2, d3tw9d2 automated match to d4ihca1 complexed with cl, gol |
PDB Entry: 3tw9 (more details), 1.7 Å
SCOPe Domain Sequences for d3tw9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tw9c1 d.54.1.0 (C:5-118) automated matches {Salmonella enterica [TaxId: 550537]} nlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapflvg kdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllgg
Timeline for d3tw9c1: