Lineage for d3thuc1 (3thu C:1-112)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555460Species Sphingomonas sp. [TaxId:314266] [267885] (1 PDB entry)
  8. 2555463Domain d3thuc1: 3thu C:1-112 [265384]
    Other proteins in same PDB: d3thua2, d3thua3, d3thub2, d3thub3, d3thuc2, d3thuc3
    automated match to d4il2a1
    complexed with cl, gol, mg, unx

Details for d3thuc1

PDB Entry: 3thu (more details), 1.8 Å

PDB Description: crystal structure of an enolase from sphingomonas sp. ska58 (efi target efi-501683) with bound mg
PDB Compounds: (C:) Mandelate racemase / muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d3thuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3thuc1 d.54.1.0 (C:1-112) automated matches {Sphingomonas sp. [TaxId: 314266]}
mpkiidakviitcpgrnfvtlkimtdegvyglgdatlngrelavasyltdhvipcligrd
ahriedlwqylykgaywrrgpvtmtaiaavdmalwdikgkiaglpvyqllgg

SCOPe Domain Coordinates for d3thuc1:

Click to download the PDB-style file with coordinates for d3thuc1.
(The format of our PDB-style files is described here.)

Timeline for d3thuc1: