SCOPe 2.07: Domain d3su3a1: 3su3 A:986-1180

Lineage for d3su3a1 (3su3 A:986-1180)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (22 PDB entries)

8. Domain d3su3a1: 3su3 A:986-1180 [265370]
   Other proteins in same PDB: d3su3a2
   automated match to d3sv6a_
   complexed with so4, su3, zn

Details for d3su3a1

PDB Entry: 3su3, 1.3 Å

PDB Description: crystal structure of ns3/4a protease in complex with vaniprevir

PDB Compounds: (A:) NS3 protease, NS4A protein

SCOPe Domain Sequences for d3su3a1:

Sequence; same for both SEQRES and ATOM records:

>d3su3a1 b.47.1.3 (A:986-1180) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
mkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtfla
tsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdly
lvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavstrgvak
avdfipveslettmr

Timeline for d3su3a1:

• d3su3a1 first appeared in SCOPe 2.05, called d3su3a_
  
• d3su3a1 appears in SCOPe 2.06
  
• d3su3a1 appears in the current release, SCOPe 2.08