Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein automated matches [190296] (11 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [267861] (7 PDB entries) |
Domain d3sajc1: 3saj C:4-373 [265348] Other proteins in same PDB: d3saja2, d3saja3, d3sajb2, d3sajc2, d3sajd2 automated match to d3h5va_ complexed with nag |
PDB Entry: 3saj (more details), 2.5 Å
SCOPe Domain Sequences for d3sajc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sajc1 c.93.1.1 (C:4-373) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} pnniqigglfpnqqsqehaafrfalsqlteppkllpqidivnisdsfemtyrfcsqfskg vyaifgfyerrtvnmltsfcgalhvcfitpsfpvdtsnqfvlqlrpelqealisiidhyk wqtfvyiydadrglsvlqrvldtaaeknwqvtavnilttteegyrmlfqdlekkkerlvv vdceserlnailgqivklekngigyhyilanlgfmdidlnkfkesganvtgfqlvnytdt iparimqqwrtsdsrdhtrvdwkrpkytsaltydgvkvmaeafqslrrqridisrrgnag dclanpavpwgqgidiqralqqvrfegltgnvqfnekgrrtnytlhviemkhdgirkigy wneddkfvpa
Timeline for d3sajc1: