Lineage for d3sajc1 (3saj C:4-373)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520549Protein automated matches [190296] (11 species)
    not a true protein
  7. 2520579Species Norway rat (Rattus norvegicus) [TaxId:10116] [267861] (7 PDB entries)
  8. 2520594Domain d3sajc1: 3saj C:4-373 [265348]
    Other proteins in same PDB: d3saja2, d3saja3, d3sajb2, d3sajc2, d3sajd2
    automated match to d3h5va_
    complexed with nag

Details for d3sajc1

PDB Entry: 3saj (more details), 2.5 Å

PDB Description: crystal structure of glutamate receptor glua1 amino terminal domain
PDB Compounds: (C:) Glutamate receptor 1

SCOPe Domain Sequences for d3sajc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sajc1 c.93.1.1 (C:4-373) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pnniqigglfpnqqsqehaafrfalsqlteppkllpqidivnisdsfemtyrfcsqfskg
vyaifgfyerrtvnmltsfcgalhvcfitpsfpvdtsnqfvlqlrpelqealisiidhyk
wqtfvyiydadrglsvlqrvldtaaeknwqvtavnilttteegyrmlfqdlekkkerlvv
vdceserlnailgqivklekngigyhyilanlgfmdidlnkfkesganvtgfqlvnytdt
iparimqqwrtsdsrdhtrvdwkrpkytsaltydgvkvmaeafqslrrqridisrrgnag
dclanpavpwgqgidiqralqqvrfegltgnvqfnekgrrtnytlhviemkhdgirkigy
wneddkfvpa

SCOPe Domain Coordinates for d3sajc1:

Click to download the PDB-style file with coordinates for d3sajc1.
(The format of our PDB-style files is described here.)

Timeline for d3sajc1: