Lineage for d3pk7f2 (3pk7 F:114-405)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2445978Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)
  8. 2445992Domain d3pk7f2: 3pk7 F:114-405 [265193]
    Other proteins in same PDB: d3pk7a1, d3pk7a3, d3pk7b1, d3pk7b3, d3pk7c1, d3pk7c3, d3pk7d1, d3pk7d3, d3pk7e1, d3pk7e3, d3pk7f1, d3pk7f3, d3pk7g1, d3pk7g3, d3pk7h1, d3pk7h3
    automated match to d4il2a2
    complexed with gol, mg

Details for d3pk7f2

PDB Entry: 3pk7 (more details), 1.64 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site
PDB Compounds: (F:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3pk7f2:

Sequence, based on SEQRES records: (download)

>d3pk7f2 c.1.11.0 (F:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d3pk7f2 c.1.11.0 (F:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiesslpaehvwstekyl
nhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqesl
rlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhv
rtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflages
pghgvdideelaakypyeraslpvnrledgtlwhw

SCOPe Domain Coordinates for d3pk7f2:

Click to download the PDB-style file with coordinates for d3pk7f2.
(The format of our PDB-style files is described here.)

Timeline for d3pk7f2: