SCOPe 2.07: Domain d3pewa2: 3pew A:287-481

Lineage for d3pewa2 (3pew A:287-481)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (13 PDB entries)

8. Domain d3pewa2: 3pew A:287-481 [265178]
   automated match to d3rrma2
   protein/RNA complex; complexed with adp, bef, mg, no3

Details for d3pewa2

PDB Entry: 3pew, 1.5 Å

PDB Description: s. cerevisiae dbp5 l327v bound to rna and adp bef3

PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d3pewa2:

Sequence; same for both SEQRES and ATOM records:

>d3pewa2 c.37.1.0 (A:287-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pnantlelqtnevnvdaikqlymdckneadkfdvltelygvmtigssiifvatkktanvl
ygklkseghevsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnyd
lptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvpt
ddwdevekivkkvlk

Timeline for d3pewa2:

• d3pewa2 first appeared in SCOPe 2.05
  
• d3pewa2 appears in SCOPe 2.06
  
• d3pewa2 appears in the current release, SCOPe 2.08