Lineage for d3p6yp_ (3p6y P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2559336Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2559337Protein automated matches [190896] (11 species)
    not a true protein
  7. 2559375Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)
  8. 2559440Domain d3p6yp_: 3p6y P: [265158]
    automated match to d4c7qa_
    protein/RNA complex

Details for d3p6yp_

PDB Entry: 3p6y (more details), 2.9 Å

PDB Description: CF Im25-CF Im68-UGUAA complex
PDB Compounds: (P:) Cleavage and polyadenylation specificity factor subunit 6

SCOPe Domain Sequences for d3p6yp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p6yp_ d.58.7.0 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskklmdl
lpkrelhgqnpvvtp

SCOPe Domain Coordinates for d3p6yp_:

Click to download the PDB-style file with coordinates for d3p6yp_.
(The format of our PDB-style files is described here.)

Timeline for d3p6yp_: