Class b: All beta proteins [48724] (165 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.2: Alanine racemase [88682] (1 protein) |
Protein Alanine racemase [50623] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries) |
Domain d1bd0b1: 1bd0 B:2-11,B:245-381 [26481] Other proteins in same PDB: d1bd0a2, d1bd0b2 complexed with in5 |
PDB Entry: 1bd0 (more details), 1.6 Å
SCOP Domain Sequences for d1bd0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bd0b1 b.49.2.2 (B:2-11,B:245-381) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]} ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin yevpctisyrvpriffrhkrimevrnai
Timeline for d1bd0b1: