PDB entry 1bd0

View 1bd0 on RCSB PDB site
Description: alanine racemase complexed with alanine phosphonate
Class: isomerase
Keywords: alanine, isomerase, pyridoxal phosphate, alanine phosphonate
Deposited on 1998-05-12, released 1998-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.24
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alanine racemase
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bd0a1, d1bd0a2
  • Chain 'B':
    Compound: alanine racemase
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bd0b1, d1bd0b2
  • Heterogens: IN5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bd0A (A:)
    mndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagas
    rlavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysg
    pfpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsy
    qytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyp
    lkeafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvd
    gqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpcti
    syrvpriffrhkrimevrnaigagessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bd0A (A:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bd0B (B:)
    mndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagas
    rlavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysg
    pfpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsy
    qytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyp
    lkeafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvd
    gqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpcti
    syrvpriffrhkrimevrnaigagessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bd0B (B:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnai