![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.5: PsbZ-like [161055] (2 families) ![]() automatically mapped to Pfam PF01737 |
![]() | Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
![]() | Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries) |
![]() | Domain d3a0hz_: 3a0h Z: [264659] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0hz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0hz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv
Timeline for d3a0hz_: