SCOPe 2.07: Domain d2xaja1: 2xaj A:171-273

Lineage for d2xaja1 (2xaj A:171-273)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (4 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries)
   Uniprot O60341 169-279

8. Domain d2xaja1: 2xaj A:171-273 [264577]
   Other proteins in same PDB: d2xaja2, d2xaja3, d2xajb1, d2xajb2
   complexed with fad, tca

Details for d2xaja1

PDB Entry: 2xaj, 3.3 Å

PDB Description: crystal structure of lsd1-corest in complex with (-)-trans-2-phenylcyclopropyl-1-amine

PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2xaja1:

Sequence; same for both SEQRES and ATOM records:

>d2xaja1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

Timeline for d2xaja1:

• d2xaja1 first appeared in SCOPe 2.05
  
• d2xaja1 appears in SCOPe 2.06
  
• d2xaja1 appears in the current release, SCOPe 2.08