SCOPe 2.07: Domain d2qjja2: 2qjj A:112-402

Lineage for d2qjja2 (2qjj A:112-402)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:48935] [267802] (3 PDB entries)

8. Domain d2qjja2: 2qjj A:112-402 [264461]
   Other proteins in same PDB: d2qjja1, d2qjjb1, d2qjjc1, d2qjjd1
   automated match to d4il2a2
   complexed with mg

Details for d2qjja2

PDB Entry: 2qjj, 1.8 Å

PDB Description: Crystal structure of D-Mannonate dehydratase from Novosphingobium aromaticivorans

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjja2:

Sequence; same for both SEQRES and ATOM records:

>d2qjja2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepa
daslpsvtgwdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyq
lfwledctpaenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagg
lthlrriadlaslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavf
phdywfekgelfvgetpghgvdideelaakypykpaylpvarledgtmwnw

Timeline for d2qjja2:

• d2qjja2 first appeared in SCOPe 2.05
  
• d2qjja2 appears in SCOPe 2.06
  
• d2qjja2 appears in the current release, SCOPe 2.08