SCOPe 2.08: Domain d2obca2: 2obc A:147-367

Lineage for d2obca2 (2obc A:147-367)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [267798] (11 PDB entries)

8. Domain d2obca2: 2obc A:147-367 [264436]
   Other proteins in same PDB: d2obca1, d2obca3, d2obcb1, d2obcb3
   automated match to d2b3za1
   complexed with rp5

Details for d2obca2

PDB Entry: 2obc, 3 Å

PDB Description: the crystal structure of ribd from escherichia coli in complex with a substrate analogue, ribose 5-phosphate (beta form), bound to the active site of the reductase domain

PDB Compounds: (A:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2obca2:

Sequence, based on SEQRES records:

>d2obca2 c.71.1.0 (A:147-367) automated matches {Escherichia coli [TaxId: 83333]}
pyiqlklgasldgrtamasgesqwitspqarrdvqllraqshailtssatvladdpaltv
rwseldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpet
vrtllipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkll
gsdarglctlpglekladapqfkfkeirhvgpdvclhlvga

Sequence, based on observed residues (ATOM records):

>d2obca2 c.71.1.0 (A:147-367) automated matches {Escherichia coli [TaxId: 83333]}
pyiqlklgasldgrtamesqwitspqarrdvqllraqshailtssatvladdpaltvrws
eldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpetvrt
llipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkllgsd
arglctlpgpqfkfkeirhvgpdvclhlvga

Timeline for d2obca2:

• d2obca2 first appeared in SCOPe 2.05
  
• d2obca2 appears in SCOPe 2.07