![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
![]() | Protein automated matches [226856] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
![]() | Domain d2l3ga1: 2l3g A:11-126 [264366] Other proteins in same PDB: d2l3ga2 automated match to d1wyra_ |
PDB Entry: 2l3g (more details)
SCOPe Domain Sequences for d2l3ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l3ga1 a.40.1.0 (A:11-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} mnsaeqtvtwlitlgvlespkktisdpegflqaslkdgvvlcrllerllpgtiekvypep rseseclsnireflrgcgaslrletfdandlyqgqnfnkvlsslvtlnkvtadigl
Timeline for d2l3ga1: