SCOPe 2.07: Domain d2l3ga1: 2l3g A:11-126

Lineage for d2l3ga1 (2l3g A:11-126)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d2l3ga1: 2l3g A:11-126 [264366]
   Other proteins in same PDB: d2l3ga2
   automated match to d1wyra_

Details for d2l3ga1

PDB Entry: 2l3g

PDB Description: Solution NMR Structure of CH domain of Rho guanine nucleotide exchange factor 7 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4495E

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d2l3ga1:

Sequence; same for both SEQRES and ATOM records:

>d2l3ga1 a.40.1.0 (A:11-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnsaeqtvtwlitlgvlespkktisdpegflqaslkdgvvlcrllerllpgtiekvypep
rseseclsnireflrgcgaslrletfdandlyqgqnfnkvlsslvtlnkvtadigl

Timeline for d2l3ga1:

• d2l3ga1 first appeared in SCOPe 2.05, called d2l3ga_
  
• d2l3ga1 appears in SCOPe 2.06
  
• d2l3ga1 appears in the current release, SCOPe 2.08