Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) |
Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins) Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1) |
Protein SRU_2040 [267643] (1 species) |
Species Salinibacter ruber DSM 13855 [TaxId:309807] [267702] (1 PDB entry) |
Domain d2kcqa1: 2kcq A:1-145 [264348] Other proteins in same PDB: d2kcqa2 |
PDB Entry: 2kcq (more details)
SCOPe Domain Sequences for d2kcqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kcqa1 c.97.3.1 (A:1-145) SRU_2040 {Salinibacter ruber DSM 13855 [TaxId: 309807]} mkttpdildqirvhgadaypeegcgfllgtvtddgdnrvaalhratnrrseqrtrryelt addyraadaaaqeqgldvvgvyhshpdhparpsatdleeatfpgftyvivsvrdgapeal tawalapdrsefhredivrpdpeap
Timeline for d2kcqa1: