Lineage for d2kcqa1 (2kcq A:1-145)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2526149Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2526150Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2526202Protein SRU_2040 [267643] (1 species)
  7. 2526203Species Salinibacter ruber DSM 13855 [TaxId:309807] [267702] (1 PDB entry)
  8. 2526204Domain d2kcqa1: 2kcq A:1-145 [264348]
    Other proteins in same PDB: d2kcqa2

Details for d2kcqa1

PDB Entry: 2kcq (more details)

PDB Description: solution structure of protein sru_2040 from salinibacter ruber (strain dsm 13855) . northeast structural genomics consortium target srr106
PDB Compounds: (A:) Mov34/MPN/PAD-1 family

SCOPe Domain Sequences for d2kcqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kcqa1 c.97.3.1 (A:1-145) SRU_2040 {Salinibacter ruber DSM 13855 [TaxId: 309807]}
mkttpdildqirvhgadaypeegcgfllgtvtddgdnrvaalhratnrrseqrtrryelt
addyraadaaaqeqgldvvgvyhshpdhparpsatdleeatfpgftyvivsvrdgapeal
tawalapdrsefhredivrpdpeap

SCOPe Domain Coordinates for d2kcqa1:

Click to download the PDB-style file with coordinates for d2kcqa1.
(The format of our PDB-style files is described here.)

Timeline for d2kcqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kcqa2