Lineage for d2i4ia1 (2i4i A:411-580)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480081Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)
  8. 2480171Domain d2i4ia1: 2i4i A:411-580 [264311]
    Other proteins in same PDB: d2i4ia2
    automated match to d2j0ub2
    complexed with amp

Details for d2i4ia1

PDB Entry: 2i4i (more details), 2.2 Å

PDB Description: Crystal Structure of human DEAD-box RNA helicase DDX3X
PDB Compounds: (A:) ATP-dependent RNA helicase DDX3X

SCOPe Domain Sequences for d2i4ia1:

Sequence, based on SEQRES records: (download)

>d2i4ia1 c.37.1.0 (A:411-580) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsenitqkvvwveesdkrsflldllnatgkdsltlvfvetkkgadsledflyhegyacts
ihgdrsqrdreealhqfrsgkspilvatavaargldisnvkhvinfdlpsdieeyvhrig
rtgrvgnlglatsffnerninitkdlldllveakqevpswlenmayehhy

Sequence, based on observed residues (ATOM records): (download)

>d2i4ia1 c.37.1.0 (A:411-580) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsenitqkvvwveesdkrsflldllnatgkdsltlvfvetkkgadsledflyhegyacts
ihgdrsqrdreealhqfrsgkspilvatavaargldisnvkhvinfdlpsdieeyvhrig
rtgrnlglatsffnerninitkdlldllveakqevpswlenmayehhy

SCOPe Domain Coordinates for d2i4ia1:

Click to download the PDB-style file with coordinates for d2i4ia1.
(The format of our PDB-style files is described here.)

Timeline for d2i4ia1: