SCOPe 2.07: Domain d2hnlb1: 2hnl B:26-101

Lineage for d2hnlb1 (2hnl B:26-101)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Onchocerca volvulus [TaxId:6282] [267780] (1 PDB entry)

8. Domain d2hnlb1: 2hnl B:26-101 [264302]
   Other proteins in same PDB: d2hnla2, d2hnlb2
   automated match to d1zl9a1
   complexed with gsh

Details for d2hnlb1

PDB Entry: 2hnl, 2 Å

PDB Description: structure of the prostaglandin d synthase from the parasitic nematode onchocerca volvulus

PDB Compounds: (B:) Glutathione S-transferase 1

SCOPe Domain Sequences for d2hnlb1:

Sequence; same for both SEQRES and ATOM records:

>d2hnlb1 c.47.1.0 (B:26-101) automated matches {Onchocerca volvulus [TaxId: 6282]}
ekytltyfngrgraevirllfalanvsyednritrdewkylkprtpfghvpmlnvsgnvl
geshaielllggrfgl

Timeline for d2hnlb1:

• d2hnlb1 first appeared in SCOPe 2.05
  
• d2hnlb1 appears in SCOPe 2.06
  
• d2hnlb1 appears in the current release, SCOPe 2.08