Lineage for d1df9a_ (1df9 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 562627Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 562628Protein NS3 protease [50600] (2 species)
  7. 562629Species Dengue virus serotype 2 [50602] (2 PDB entries)
  8. 562630Domain d1df9a_: 1df9 A: [26420]
    Other proteins in same PDB: d1df9c_

Details for d1df9a_

PDB Entry: 1df9 (more details), 2.1 Å

PDB Description: dengue virus ns3-protease complexed with mung-bean bowman-birk inhibitor

SCOP Domain Sequences for d1df9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1df9a_ b.47.1.3 (A:) NS3 protease {Dengue virus serotype 2}
wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd

SCOP Domain Coordinates for d1df9a_:

Click to download the PDB-style file with coordinates for d1df9a_.
(The format of our PDB-style files is described here.)

Timeline for d1df9a_: