SCOPe 2.04: Domain d1ns3.2: 1ns3 B:,D:

Lineage for d1ns3.2 (1ns3 B:,D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (5 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
   Uniprot P27958 1027-1206,1678-1669
   Uniprot P26662 1029-1202,1677-1689
   Uniprot O36579 1054-1207

8. Domain d1ns3.2: 1ns3 B:,D: [26413]
   complexed with zn

Details for d1ns3.2

PDB Entry: 1ns3, 2.8 Å

PDB Description: structure of hcv protease (bk strain)

PDB Compounds: (B:) NS3 protease, (D:) ns4a peptide

SCOPe Domain Sequences for d1ns3.2:

Sequence; same for both SEQRES and ATOM records:

>g1ns3.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmrXk
gsvvivgriils

Timeline for d1ns3.2:

• d1ns3.2 first appeared (with stable ids) in SCOP 1.55
  
• d1ns3.2 appears in SCOPe 2.03
  
• d1ns3.2 appears in SCOPe 2.05
  
• d1ns3.2 appears in the current release, SCOPe 2.08