Lineage for d4qjec_ (4qje C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2516430Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2516431Protein automated matches [190683] (59 species)
    not a true protein
  7. 2517355Species Staphylococcus aureus [TaxId:93062] [225575] (13 PDB entries)
  8. 2517372Domain d4qjec_: 4qje C: [263718]
    automated match to d4qn2a_
    complexed with b3p, na, peg, trs; mutant

Details for d4qjec_

PDB Entry: 4qje (more details), 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of apo betaine aldehyde dehydrogenase (betb) g234s mutant from staphylococcus aureus (idp00699) with bme-free sulfinic acid form of cys289
PDB Compounds: (C:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d4qjec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qjec_ c.82.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe
sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa
gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk
pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftgsietgkh
imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns
ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr
pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag
avfskdigkaqrvanklklgtvwindfhpyfaqapwggykqsgigrelgkegleeylvsk
hiltntnpqlvnwfsk

SCOPe Domain Coordinates for d4qjec_:

Click to download the PDB-style file with coordinates for d4qjec_.
(The format of our PDB-style files is described here.)

Timeline for d4qjec_: