SCOPe 2.07: Domain d4q59a2: 4q59 A:154-263

Lineage for d4q59a2 (4q59 A:154-263)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d4q59a2: 4q59 A:154-263 [263633]
   Other proteins in same PDB: d4q59a1, d4q59b1
   automated match to d4q59b2

Details for d4q59a2

PDB Entry: 4q59, 2.3 Å

PDB Description: Crystal structure of plectin 1a actin-binding domain

PDB Compounds: (A:) Plectin

SCOPe Domain Sequences for d4q59a2:

Sequence; same for both SEQRES and ATOM records:

>d4q59a2 a.40.1.0 (A:154-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp

Timeline for d4q59a2:

• d4q59a2 first appeared in SCOPe 2.05
  
• d4q59a2 appears in SCOPe 2.06
  
• d4q59a2 appears in the current release, SCOPe 2.08