Lineage for d1elaa_ (1ela A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111805Protein Elastase [50536] (3 species)
  7. 111811Species Pig (Sus scrofa) [TaxId:9823] [50538] (48 PDB entries)
  8. 111836Domain d1elaa_: 1ela A: [26257]

Details for d1elaa_

PDB Entry: 1ela (more details), 1.8 Å

PDB Description: Analogous inhibitors of elastase do not always bind analogously

SCOP Domain Sequences for d1elaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elaa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1elaa_:

Click to download the PDB-style file with coordinates for d1elaa_.
(The format of our PDB-style files is described here.)

Timeline for d1elaa_: