Lineage for d1qr3e_ (1qr3 E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60548Protein Elastase [50536] (3 species)
  7. 60554Species Pig (Sus scrofa) [TaxId:9823] [50538] (46 PDB entries)
  8. 60580Domain d1qr3e_: 1qr3 E: [26255]

Details for d1qr3e_

PDB Entry: 1qr3 (more details), 1.6 Å

PDB Description: structure of porcine pancreatic elastase in complex with fr901277, a novel macrocyclic inhibitor of elastases at 1.6 angstrom resolution

SCOP Domain Sequences for d1qr3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr3e_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1qr3e_:

Click to download the PDB-style file with coordinates for d1qr3e_.
(The format of our PDB-style files is described here.)

Timeline for d1qr3e_: