![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Zymomonas mobilis [TaxId:542] [256546] (1 PDB entry) |
![]() | Domain d4bk9c_: 4bk9 C: [262517] automated match to d4bk9b_ complexed with so4 |
PDB Entry: 4bk9 (more details), 2.77 Å
SCOPe Domain Sequences for d4bk9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bk9c_ c.1.10.0 (C:) automated matches {Zymomonas mobilis [TaxId: 542]} rdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevpg avvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgld lgldrfkffpaenigglpalksmasvfrqvrfcptggitpasapkylenpsilcvggswv vpagkpdvakitalakeasafkraav
Timeline for d4bk9c_: