SCOPe 2.04: Domain d4este_: 4est E:

Lineage for d4este_ (4est E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (116 PDB entries)

8. Domain d4este_: 4est E: [26243]
   complexed with ca, so4

Details for d4este_

PDB Entry: 4est, 1.78 Å

PDB Description: crystal structure of the covalent complex formed by a peptidyl alpha, alpha-difluoro-beta-keto amide with porcine pancreatic elastase at 1.78-angstroms resolution

PDB Compounds: (E:) elastase

SCOPe Domain Sequences for d4este_:

Sequence; same for both SEQRES and ATOM records:

>d4este_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d4este_:

• d4este_ first appeared (with stable ids) in SCOP 1.55
  
• d4este_ appears in SCOPe 2.03
  
• d4este_ appears in SCOPe 2.05
  
• d4este_ appears in the current release, SCOPe 2.08