SCOPe 2.08: Domain d3l71e1: 3l71 E:1-69

Lineage for d3l71e1 (3l71 E:1-69)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries)

8. Domain d3l71e1: 3l71 E:1-69 [262293]
   Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
   automated match to d3l70e1
   complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71e1

PDB Entry: 3l71, 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3l71e1:

Sequence; same for both SEQRES and ATOM records:

>d3l71e1 f.23.12.0 (E:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

Timeline for d3l71e1:

• d3l71e1 first appeared in SCOPe 2.05
  
• d3l71e1 appears in SCOPe 2.07