Class b: All beta proteins [48724] (119 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins) |
Protein Thrombin [50531] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries) |
Domain d1bth.2: 1bth J:,K: [26206] Other proteins in same PDB: d1bthp_, d1bthq_ mutant |
PDB Entry: 1bth (more details), 2.3 Å
SCOP Domain Sequences for d1bth.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1bth.2 b.47.1.2 (J:,K:) Thrombin {Cow (Bos taurus)} geadcglrplfekksledkterellesyidgXivegsdaeigmspwqvmlfrkspqellc gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw ttnvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacqgdsggp fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvi
Timeline for d1bth.2: