SCOP 1.63: Domain d1bth.2: 1bth J:,K:

Lineage for d1bth.2 (1bth J:,K:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)

8. Domain d1bth.2: 1bth J:,K: [26206]
   Other proteins in same PDB: d1bthp_, d1bthq_
   mutant

Details for d1bth.2

PDB Entry: 1bth, 2.3 Å

PDB Description: structure of thrombin complexed with bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d1bth.2:

Sequence; same for both SEQRES and ATOM records:

>g1bth.2 b.47.1.2 (J:,K:) Thrombin {Cow (Bos taurus)}
geadcglrplfekksledkterellesyidgXivegsdaeigmspwqvmlfrkspqellc
gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
ttnvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacqgdsggp
fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvi

Timeline for d1bth.2:

• d1bth.2 first appeared (with stable ids) in SCOP 1.55
  
• d1bth.2 appears in SCOP 1.61
  
• d1bth.2 appears in SCOP 1.65
  
• d1bth.2 appears in the current release, SCOPe 2.08