Lineage for d4v2ga2 (4v2g A:68-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728122Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2728123Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)
  8. 2728155Domain d4v2ga2: 4v2g A:68-208 [261727]
    Other proteins in same PDB: d4v2ga1, d4v2ga3, d4v2gb1, d4v2gb3
    automated match to d1bjza2
    complexed with ctc, itc, mg

Details for d4v2ga2

PDB Entry: 4v2g (more details), 2.71 Å

PDB Description: Tetracycline repressor TetR(D) bound to chlortetracycline and iso- chlortetracycline
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4v2ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v2ga2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

SCOPe Domain Coordinates for d4v2ga2:

Click to download the PDB-style file with coordinates for d4v2ga2.
(The format of our PDB-style files is described here.)

Timeline for d4v2ga2: