Lineage for d1bmm.1 (1bmm L:,H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167950Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)
  6. 168261Protein Thrombin [50531] (2 species)
  7. 168297Species Human (Homo sapiens) [TaxId:9606] [50532] (130 PDB entries)
  8. 168406Domain d1bmm.1: 1bmm L:,H: [26169]

Details for d1bmm.1

PDB Entry: 1bmm (more details), 2.6 Å

PDB Description: human alpha-thrombin complexed with [s-(r*,r*)]-4-[(aminoiminomethyl)amino]-n-[[1-[3-hydroxy-2-[(2-naphthalenylsulfonyl)amino]-1-oxopropyl]-2-pyrrolidinyl] methyl]butanamide (bms-186282)

SCOP Domain Sequences for d1bmm.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1bmm.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)}
geadcglrplfekksledkterellesyXivegsdaeigmspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

SCOP Domain Coordinates for d1bmm.1:

Click to download the PDB-style file with coordinates for d1bmm.1.
(The format of our PDB-style files is described here.)

Timeline for d1bmm.1: