Lineage for d4ub8h_ (4ub8 H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026489Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 3026490Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 3026522Protein automated matches [191001] (5 species)
    not a true protein
  7. 3026534Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (8 PDB entries)
  8. 3026537Domain d4ub8h_: 4ub8 H: [261434]
    Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_
    automated match to d3bz2h_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8h_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d4ub8h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8h_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d4ub8h_:

Click to download the PDB-style file with coordinates for d4ub8h_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8h_: