Lineage for d4ub8c_ (4ub8 C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028864Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 3028865Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 3028866Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 3028885Protein automated matches [191285] (5 species)
    not a true protein
  7. 3028901Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries)
  8. 3028911Domain d4ub8c_: 4ub8 C: [261431]
    Other proteins in same PDB: d4ub8a_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_
    automated match to d3arcc_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8c_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (C:) Photosystem II 44 kDa reaction center protein

SCOPe Domain Sequences for d4ub8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8c_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
whagraraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d4ub8c_:

Click to download the PDB-style file with coordinates for d4ub8c_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8c_: