![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
![]() | Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) ![]() automatically mapped to Pfam PF00421 |
![]() | Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
![]() | Protein automated matches [191285] (5 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries) |
![]() | Domain d4ub8c_: 4ub8 C: [261431] Other proteins in same PDB: d4ub8a_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_ automated match to d3arcc_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 4ub8 (more details), 1.95 Å
SCOPe Domain Sequences for d4ub8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ub8c_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl whagraraaaagfekgidresepvlsmpsld
Timeline for d4ub8c_: