SCOPe 2.08: Domain d4ub6t_: 4ub6 T:

Lineage for d4ub6t_ (4ub6 T:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family)
   automatically mapped to Pfam PF01405

5. Family f.23.34.1: PsbT-like [161030] (2 proteins)
   Pfam PF01405

6. Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries)

8. Domain d4ub6t_: 4ub6 T: [261426]
   Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6j_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6o_, d4ub6u_, d4ub6v_, d4ub6x_, d4ub6z_
   automated match to d2axtt1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub6t_

PDB Entry: 4ub6, 1.95 Å

PDB Description: native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser

PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d4ub6t_:

Sequence; same for both SEQRES and ATOM records:

>d4ub6t_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

Timeline for d4ub6t_:

• d4ub6t_ first appeared in SCOPe 2.04
  
• d4ub6t_ appears in SCOPe 2.07