Lineage for d4r9va_ (4r9v A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1623025Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1623026Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families) (S)
  5. 1623490Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 1623491Protein automated matches [190965] (12 species)
    not a true protein
  7. 1623519Species Photobacterium damselae [TaxId:38293] [261399] (1 PDB entry)
  8. 1623520Domain d4r9va_: 4r9v A: [261400]
    automated match to d2c83a_
    complexed with ca

Details for d4r9va_

PDB Entry: 4r9v (more details), 2.3 Å

PDB Description: Crystal structure of sialyltransferase from photobacterium damselae, residues 113-497 corresponding to the gt-b domain
PDB Compounds: (A:) Sialyltransferase 0160

SCOPe Domain Sequences for d4r9va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r9va_ c.87.1.0 (A:) automated matches {Photobacterium damselae [TaxId: 38293]}
mtlevyidhaslpslqqlihiiqakdeypsnqrfvswkrvtvdadnanklnihtyplkgn
ntspemvaaideyaqsknrlniefytntahvfnnlppiiqplynnekvkishislyddgs
seyvslyqwkdtpnkietlegevsllanylagtspdapkgmgnrynwhklydtdyyflre
dyldveanlhdlrdylgssakqmpwdefaklsdsqqtlfldivgfdkeqlqqqysqsplp
nfiftgtttwaggetkeyyaqqqvnvinnainetspyylgkdydlffkghpaggvindii
lgsfpdminipakisfevlmmtdmlpdtvagiasslyftipadkvnfivftssdtitdre
ealksplvqvmltlgivkekdvlfwa

SCOPe Domain Coordinates for d4r9va_:

Click to download the PDB-style file with coordinates for d4r9va_.
(The format of our PDB-style files is described here.)

Timeline for d4r9va_: