SCOPe 2.07: Domain d4rbsb1: 4rbs B:31-269

Lineage for d4rbsb1 (4rbs B:31-269)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d4rbsb1: 4rbs B:31-269 [261270]
   Other proteins in same PDB: d4rbsb2
   automated match to d4hl2a_
   complexed with 0rv, acy, gol, zn

Details for d4rbsb1

PDB Entry: 4rbs, 2.4 Å

PDB Description: Crystal Structure of New Delhi Metallo-beta-Lactamase-1 in the Complex with Hydrolyzed Meropenem

PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4rbsb1:

Sequence; same for both SEQRES and ATOM records:

>d4rbsb1 d.157.1.0 (B:31-269) automated matches {Klebsiella pneumoniae [TaxId: 573]}
irptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvd
tawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlap
qegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcli
kdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

Timeline for d4rbsb1:

• d4rbsb1 first appeared in SCOPe 2.04, called d4rbsb_
  
• d4rbsb1 appears in SCOPe 2.06
  
• d4rbsb1 appears in the current release, SCOPe 2.08