SCOPe 2.07: Domain d4r9jg_: 4r9j G:

Lineage for d4r9jg_ (4r9j G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.0: automated matches [191465] (1 protein)
   not a true family

6. Protein automated matches [190726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187887] (49 PDB entries)

8. Domain d4r9jg_: 4r9j G: [260785]
   automated match to d2j1gb_
   complexed with 3lj, act, ca, nag, so4

Details for d4r9jg_

PDB Entry: 4r9j, 2.1 Å

PDB Description: l-ficolin complexed to glucosamine-6-sulfate

PDB Compounds: (G:) ficolin-2

SCOPe Domain Sequences for d4r9jg_:

Sequence; same for both SEQRES and ATOM records:

>d4r9jg_ d.171.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcltgprtckdlldrghflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrvdgsvdfy
rdwatykqgfgsrlgefwlgndnihaltaqgtselrvdlvdfednyqfakyrsfkvadea
ekynlvlgafvegsagdsltfhnnqsfstkdqdndlntgncavmfqgawwyknchvsnln
grylrgthgsfanginwksgkgynysykvsemkvrpa

Timeline for d4r9jg_:

• d4r9jg_ first appeared in SCOPe 2.04
  
• d4r9jg_ appears in SCOPe 2.06
  
• d4r9jg_ appears in the current release, SCOPe 2.08