Lineage for d1pytd_ (1pyt D:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 298774Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)
  6. 298775Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 298776Species Cow (Bos taurus) [TaxId:9913] [50523] (46 PDB entries)
  8. 298822Domain d1pytd_: 1pyt D: [26058]
    Other proteins in same PDB: d1pyta_, d1pytb_, d1pytc_
    chymotrypsinogen C
    complexed with ca, zn

Details for d1pytd_

PDB Entry: 1pyt (more details), 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c

SCOP Domain Sequences for d1pytd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgapifqpnlsarvvggedaiphswpwqislqylrdntwrhtcggtlitpnhvltaahci
sntltyrvalgknnlevedeagslyvgvdtifvhekwnsflvrndialiklaetvelgdt
iqvaclpsegsllpqdypcfvtgwgrlytngpiaaelqqglqpvvdyatcsqrdwwgttv
ketmvcaggdgvisacngdsggplncqadgqwdvrgivsfgsglscntfkkptvftrvsa
yidwinqklql

SCOP Domain Coordinates for d1pytd_:

Click to download the PDB-style file with coordinates for d1pytd_.
(The format of our PDB-style files is described here.)

Timeline for d1pytd_: