SCOPe 2.04: Domain d4q0ee1: 4q0e E:3-178

Lineage for d4q0ee1 (4q0e E:3-178)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)

7. Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries)
   Uniprot Q5CGA3 Q27552

8. Domain d4q0ee1: 4q0e E:3-178 [260374]
   Other proteins in same PDB: d4q0ea2, d4q0eb2, d4q0ec2, d4q0ed2, d4q0ee2
   automated match to d1seja1
   complexed with 2xb, ndp, ufp

Details for d4q0ee1

PDB Entry: 4q0e, 2.78 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, fdump and 2-amino-4-oxo-4,7-dihydro-pyrrolo[2,3- d]pyrimidine-methyl-phenyl-l-glutamic acid.

PDB Compounds: (E:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d4q0ee1:

Sequence; same for both SEQRES and ATOM records:

>d4q0ee1 c.71.1.1 (E:3-178) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekq

Timeline for d4q0ee1:

• d4q0ee1 is new in SCOPe 2.04-stable
  
• d4q0ee1 appears in SCOPe 2.05
  
• d4q0ee1 appears in the current release, SCOPe 2.08