Lineage for d4caja_ (4caj A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608590Species Mouse (Mus musculus) [TaxId:10090] [187331] (29 PDB entries)
  8. 2608627Domain d4caja_: 4caj A: [260300]
    automated match to d1t8ca1
    complexed with ca, cl, sia, so4

Details for d4caja_

PDB Entry: 4caj (more details), 2.19 Å

PDB Description: crystallographic structure of the mouse sign-r1 crd domain in complex with sialic acid
PDB Compounds: (A:) cd209 antigen-like protein b

SCOPe Domain Sequences for d4caja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4caja_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
crlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskakgp
twmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcelkk
fwickksatpc

SCOPe Domain Coordinates for d4caja_:

Click to download the PDB-style file with coordinates for d4caja_.
(The format of our PDB-style files is described here.)

Timeline for d4caja_: