Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species North atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries) |
Domain d1bzxe_: 1bzx E: [26010] Other proteins in same PDB: d1bzxi_ complexed with ca |
PDB Entry: 1bzx (more details), 2.1 Å
SCOP Domain Sequences for d1bzxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzxe_ b.47.1.2 (E:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy
Timeline for d1bzxe_: