SCOP 1.75: Domain d1bzxe_: 1bzx E:

Lineage for d1bzxe_ (1bzx E:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species North atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries)

8. Domain d1bzxe_: 1bzx E: [26010]
   Other proteins in same PDB: d1bzxi_
   complexed with ca

Details for d1bzxe_

PDB Entry: 1bzx, 2.1 Å

PDB Description: the crystal structure of anionic salmon trypsin in complex with bovine pancreatic trypsin inhibitor

PDB Compounds: (E:) protein (trypsin)

SCOP Domain Sequences for d1bzxe_:

Sequence; same for both SEQRES and ATOM records:

>d1bzxe_ b.47.1.2 (E:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]}
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

Timeline for d1bzxe_:

• d1bzxe_ first appeared (with stable ids) in SCOP 1.55
  
• d1bzxe_ appears in SCOP 1.73
  
• d1bzxe_ appears in SCOPe 2.01
  
• d1bzxe_ appears in the current release, SCOPe 2.08